Your IP : 216.73.216.31


Current Path : /proc/thread-self/root/usr/share/locale/nl/LC_MESSAGES/
Upload File :
Current File : //proc/thread-self/root/usr/share/locale/nl/LC_MESSAGES/xkeyboard-config.mo

����$#�IHbIb&^bq�b_�b!Wcyc�c�c�c�c�c�cdd8d-<djd-�d$�d�d�d
e	ee0e%<e$be%�e�e�e�e�e�eC�e",fOf)gf&�f�f
�f�f	�f	�f�fgg g(g@gFg]gsgF�g�g�g�g�ghh0hCh
Thbhth�h�h�h�hW�hY(i�i�i�i�i�i�i�i4jDjPj_jnjuj}j�j�j�j�j�j	�j�j�j	k
k	k+$k	PkTZk�k�k�k"�k�k
l"l:lXl
il
tll�l�l�l�l�l�lm"mAmXmum�m�m�m�m(�mn, n#Mn#qn�n�n#�n"�n�no9oKo^o$ro?�o%�o�o$p*p%@pfp}p	�p�p �p�p�p�pq'qFq \q }q	�qJ�q>�qE2r&xr�r�r�r�r9�r.-s@\s@�sG�sT&t"{t�t�t�t�t�t
u!u>u\umu}u�u�u
�u�u�u�u�u
�u�uvv-vGvavzv�v�v�v�v�vw(w%1w$Ww!|w�w+�w-�w
x!x
4x?xExTx"nx�x"�x�x
�x�x y,y@y\yyy�y�y�y �y�y�y�y
z&z+z;zZzoz�z�z�z�z�z�z�z{{{-{>{Y{m{*v{#�{�{�{�{||$|$6|A[|;�|.�|(}1}C}T}'q}�}�}�}�}�}~8~L~j~�~�~�~�~�~�~)�~ 8%Sy#������34�@h�#��̀(߀�%!�G�4c�����	��݁3��.�7�I�$a���.��	͂	ׂ	�	����	���-�$6�![�(}�%��̃���8�T�
\�j�~�������ل'��*�%B�h���"����$��+�2�C�S�e�u���)��φ߆���'�=�R�"r�"��(��
�� �=$�
b�p���!��ʈ#�)�.�D�`�q���������ĉ׉�&�-�H�Y�k� t�������ˊҊ����$8�
]�k������� ��ۋ����"�8�M�"m���"��(Ќ�� �&�:�T�h�0~���ˍ؍ލ���)�;�J�S�	\�f�
{���
������Ď���	��4�&T�{���"��ۏ���;�[�x�������
Đϐ�	�&��)$�$N�'s�&��)‘$�'�&9�)`�$��'��&ג)��$(�'M�u�������͓ޓ��"� ?�	`�j�}�����ʔ��'��"�@�	`�j�p�v���������"ѕ��&�
=�K�T�f�y�������Ė%ږ&�'�A�H�a�i�	����������!˗��!�3�D�K�S�X�_������˘ݘ���.�@�\�t�������љ�	���*�#.�R�Z�f�}�(����Ϛ"��#�8�U�f�)��-��ݛ���8(�!a���	����4�����D�
U�`�i�e��7� �'�7�M�
a�l�������.Ȟ(�� �6�?�O� i��� ��#˟!�(� :�+[�%������ՠ�'�*�:�O�_�%~�)��
Ρܡ��
#�.�	H�
R�4`�&�� ��"ݢ%�%&�"L�&o�����ͣ�a�h���	����)���(�(�?�X�i�o���������ť)ʥ���8�N�k� ~����� ɦ�&�"+�)N�x�"��#��٧	��	����*�;�R�a�v���&����*Ϩ#���:�$W�#|�������ĩЩ�#�#�=8�Mv�#ĪM�^6�����%ƫ��	�$�8�K�#a�������̬Sլ&)�&P�w�1��ȭͭխ
ۭ�
��!�(�;�O�a�g�w��������� ��ݮ����-�,=�4j�����ѯ����&�
A�L�`�(|�,��Ұ!�!�2�G�$^�*��$��ӱ���;�S�o�u�����	��²ܲf��!_�%��
����ͳ���	��f,����� ��д����.�J�
^�i�q�
������ǵ"�!	�+�!?�"a�#������(ڶ� �;�L�h�{�����!̷�� �+>�j�
~�������¸ݸ�
���%�"-�&P�w������� ع��0
�;�$O�t�9��ƺֺߺ�����"&�I�\�c�#s�����	ɻ&ӻ����/�,H�!u� ��$��&ݼ,�1�E�\�o�����7����&�<�V�l�}�����*¾���*�=�U�l�����ſ߿���� �7�"J�"m�����������	
��+�1�@�Q�-q�(���"�$�%�9�?�F�_�o�t�������,��+��+�E�]�q�;��d��&�:�I�`�g�o��������������	�"�?�.\�*������	�������'�:�O�i�-��N������3�H�X�m�+}�+�����������
)�
7�B�,W���(����B��c�(��	������������&��K�e^�u��o:�J��o��Je������������������������������������������������	�����1�4�7�:�=�@�C�F�I�L�O�R�X�\�`�c�f�i�l�o�r�u�x�{�~�����������������������������������������������������������������������������������������!�$�'�+�.�1�4�7�:�=�@�D�G�J�M�P�S�V�Y�]�`�c��f�R�6q�X��W�/Y���"��%����#�&&�M�Z�g���,��!��0��'�3�P�
b�	p�z���/��(��+���1�:�A�J�F[�1��$��;��:5�"p���
��������������'�7�=�T�j�I����������� �6�K�^�n�����������e��dQ����������(�<�4N���
��������	����������	-�7�C�	L�
V�	a�+k�	��B��������$�+�G�a�{���	�������������2�M�%d�,����������%�A�1^�'��0��&��%�6�R�%[�)��!��&�����%�-?�Lm�.����&���'.�V�m�~���!�����������6� I� j���S��L��G5�+}���������C�HW�/��W��R(�A{�%��������&�?�V�m�������������
����
	��/�
<�G�]�r��������������6�Q�h�	�'��+��#��'�9)�<c�������
������*�D�2^�*������,��"�!<�"^���������&�������!�>�C�W�v��������������
�
�'�>�X�!o�����*��$����
�"�7�I�Y�)j�Q��K��82�2k�����+��1���:�X�g�~�������!��
��+�@�L�a�*u�����(��&��-!�O�[�{�'����:��G�-\���2����/���A4�v���	������G��'�/�@�'W��1�������������	$�.�	N�%X�$~�)��(����1�N�j���
���������$�
�0�G�c�/~����&���(	�/2�7b���������%��"�1�@�R�l�|�����!�(�)�9�F�.e�K���"�(�)@�j�4��5�����.�B�_�d�g�(���(���/��-�H�Y�	k�$u�����������
�'(�(P�y� �������&�
��	��/�>�S�g�!����(�)�
#&J\w�9���
%;Ol��	��
��
��	"3M]s�&���"3Ss�����
)=P+Y2�*�1�+2A*t1�+�2�*01[+�2�*�1I[z����� !BK] r����3�(	 <		]	g	o	t		�	�	�	�	+�	
,
K
k

�
�

�
�
�
�
�
#�
$"Ga h�������+�*Hew����%���"
&
:
Z
"v
�
�
�
�
!�
!?"Vy�
���*����$&K]z���
��(*+Vc%�M�.3M_Dy�"�`�]p)�M�[�
Ydx������.�'(Pdm}'�� �#!$2F y+�*��5'Fn~��%�)�
 7$Kp!|	�
�9�&� "8'[$�"�6�" AbH�#��	/&V+^/�"����
!:I5N��#��1Qc {�(�"�),"Il�
�������

#
17?w1�4�� (: c������!� �< JV !� J� [!j!�!.�!�!�!�!�!""&/"V"k"�"�"]�"(#(.#%W#<}#�#	�#�#
�#�#�#�#!�#$0$L$c$i$z$�$�$�$�$!�$"�$
%%*%:%6I%C�%&�%�%&&($&M&`&	{&�&�&*�&3�&'#6'*Z'�'�'*�'+�'((/(B([( {(�(�(�(�(�())&.))U)K).�)>�)9*'L*!t*�*�*�**�*O+X+a+)v+�+�+�+ �+,$,9,J, S,t,�,�, �,$�,"�,!-"6-"Y-%|-�-�-1�-	.$".G.].|.�.�.�.%�.
/"$/%G/0m/�/
�/�/�/�/�/0(0
40B0\02e0,�0.�0�01"1#>1b1;u1�1(�1�172C2
T2_2	{2�2�2*�2�2�2�2(313 I3j3)s3&�3�3�3�3-�3!"4 D4$e4-�4.�4�4�45)5=5Z5Cx5�5�5�56$6:6K6g6v6-�6�6�6�6�67*7$E7.j70�7!�7�7�788)8?8%Q8.w8�8�8&�8�899	29<9	W9a9x9�9-�9+�9:":$;:`:t:z:�:�:�:�:�:	�:�:1�:00;0a;�;�;�;@�;_<s<�<�<�<�<
�<	�<�<�<(�<"=	?=I=[=t=�=/�=+�=
>!>
4>?>Y>v>�>�>�>�>6�>U*?�?�?�?�?�?�?�?;@LL@�@�@�@�@�@�@AA<0AmA9�A�AN�Am&B0�B�B�B�B�BC
C(CJ=Cf�Ct�CudDR�Du-ER�E�E�E�EFFFFFFFF!F%F(F+F.F2F5F8F;F?FBFFFIFLFOFVFZF]F`FwFzF}F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�F�FGGG	GGGGGGGG!G$G'G.G1G4G7G:G=G@GCGFGIGMGQGTGXG[G^GaGdGgGjGmGqGtGwGzG}G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�Z4��d�)'Jr�S�X?��z�x� �]0�_����>�
m{� Y���
��q	���~V$U��#��+X����q��PM[OX/1%��L�� ��Q���;b�9�}=�A��@j�K������J@h������0�}OTTeY-Eh��~�|�+�U"��Wf�����
�M���y\J�,�4a(p3y<5��d���F�{hi���l,����]�'�K���	���&�f�����5B��J��������Dx5F
��/���.�B�{�z8B��^������������Q��J_�H�.(�-�wtA��a{O*����M3c�:!nFl$i~] ���-`�w�8k�x9���������y�2&%�[`1f�W��^_�3���*R�gh="�?'���I
E�U	S�c3?��������#HD�g�������j���k��^�nuEV��\��C�0���`ut��k	y8@��g�i�+?�4�fo��t�1U�leM[*�A.!\�2��$��Y��V����!�g��x��D�7�4O���:�|X�����7���|����N�C=��ZE�-�]s|��;�]���K�k���Y���g:�f��/�����Mn��������IGI�S_�~��s�/N�P���"7QB�Rv�R�6���;F&<���/D1�AoBo������^�K��ov�qX[�*�Zn�����9dDu���(<���^`PNZr&���=���6O�?!���LG8���6+�x��$��,9C���0�N��:��
��')��\`��R���0c�N�Tdi3��#\:rPTrC)�.Hj&�EFa���t�(W>����L���)��{"�sW��$K��;<n�wy��;��2���L���u���ez,�b�w8c7����Q���������|�����b>RH���������)}bmq��l.�������vbsCSh����a�@!>����uG#�o�Y
�l5��(v�G5��7���'����ktL}I}�,�����U���p��2��re�q1���j��d���z��>%���Gp4�m6
%�_�@�V�j�
m���A��me�z�Z9��ST~i��W���+ps�p#��wQ vV�-��%2���6*��I"Pa[���	=<
��H���c&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 5th level&lt;Less/Greater&gt; chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser&lt;Less/Greater&gt;; acts as onetime lock when pressed together with another 3rd level chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as Control, Control as HyperCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (3l)English (3l, chromebook)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AFNOR standardized AZERTY)French (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, AFNOR)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianIndonesian (Arab Melayu, ext. phonetic)Indonesian (Arab Melayu, phonetic)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMake unmodified Caps Lock an additional Esc, but Shift + Caps Lock behaves like regular Caps LockMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (UK layout with AltGr overrides)Maltese (US layout with AltGr overrides)Maltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian GalikMongolian ManchuMongolian Manchu GalikMongolian TodoMongolian Todo GalikMongolian XibeMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (British keyboard)Polish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic yazherty)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config-2.27.99
Report-Msgid-Bugs-To: svu@users.sourceforge.net
POT-Creation-Date: 2019-10-19 21:52+0100
PO-Revision-Date: 2019-09-29 11:50+0200
Last-Translator: Benno Schulenberg <vertaling@coevern.nl>
Language-Team: Dutch <vertaling@vrijschrift.org>
Language: nl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n != 1);
&lt;Kleiner dan/Groter dan&gt;&lt;Kleiner dan/Groter dan&gt; kiest het vijfde niveau&lt;Kleiner dan/Groter dan&gt;; vergrendelt eenmalig samen met andere vijfdeniveaukiezer&lt;Kleiner dan/Groter dan&gt;; vergrendelt eenmalig samen met andere derdeniveaukiezerderde niveau van &lt;Kleiner dan/Groter dan&gt;derde niveau van CapsLockderde niveau van linker Ctrl-toetsderde niveau van linker Windows-toetsderde niveau van Menuderde niveau van rechter Ctrl-toetsderde niveau van rechter Windows-toetsA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL-toetsenbordsymbolen: APLX Unified LayoutAPL-toetsenbordsymbolen: IBM APL2APL-toetsenbordsymbolen: Manugistics APL*PLUS IIAPL-toetsenbordsymbolen: Unified LayoutAPL-toetsenbordsymbolen: saxATM/telefoonstijlAcer AirKey VAcer C300Acer Ferrari 4000Acer-laptopHet standaardgedrag toevoegen aan de Menu-toetsEsperanto-letters met accenten toevoegenValutatekens aan bepaalde toetsen toevoegenAdvance Scorpius KIAfghaansAkaansAlbaneesAlbanees (Plisi)Het verbreken van 'grabs' via toetsenbord toestaan (veiligheidsrisico)Het loggen van 'grabs' en 'window trees' toestaanAlt en Meta zitten op de Alt-toetsenAlt zit op de rechter Windows-toets, Super op de Menu-toetsAlt zit op de Windows-toetsen én op de gewone Alt-toetsenAlt- en Windows-toetsen omwisselenAlt + CapsLockAlt + CtrlAlt + ShiftAlt + SpatieGedrag van Alt/Windows-toetsenAmhaarsElke Alt-toetsElke Windows-toetsElke Windows-toets (ingedrukt gehouden)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: PC-toetsen emuleren (PrtSc, Scroll-Lock, Pause, NumLock)Apple-laptopArabischArabisch (AZERTY)Arabisch (AZERTY/cijfers)Arabisch (Algerije)Arabisch (Buckwalter)Arabisch (Macintosh)Arabisch (Marokko)Arabisch (OLPC)Arabisch (Pakistan)Arabisch (QWERTY)Arabisch (Sun type 6/7)Arabisch (Syrië)Arabisch (cijfers)Arabisch (QWERTY/cijfers)Arabisch (met uitbreidingen voor andere Arabisch-geschreven talen en voorkeur voor Arabische cijfers)Arabisch (met uitbreidingen voor andere Arabisch-geschreven talen en voorkeur voor Europese cijfers)ArmeensArmeens (OLPC, fonetisch)Armeens (alternatief Oosters)Armeens (alternatief fonetisch)Armeens (Oosters)Armeens (fonetisch)Armeens (Westers)Asturisch (Spanje, met onderpunts H en onderpunts L)Asus-laptopLinksonderLinks van de "A"AtsinaAvatimeAvestischAzerbeidzjaansAzerbeidzjaans (Cyrillisch)Azona RF2300 Wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; vergrendelt eenmalig samen met andere derdeniveaukiezerBambaraBengaalsBengaals (India)Bengaals (India, Baishakhi Inscript)Bengaals (India, Baishakhi)Bengaals (India, Bornona)Bengaals (India, Probhat)Bengaals (India, Uni Gitanjali)Bengaals (Probhat)BasjkiersWit-RussischWit-Russisch (Latijns)Wit-Russisch (historisch)BelgischBelgisch (Sun type 6/7)Belgisch (Wang 724 AZERTY)Belgisch (alternatief ISO)Belgisch (alternatief)Belgisch (alternatief, enkel Latin-9)Belgisch (alternatief, met Sun dode toetsen)Belgisch (zonder dode toetsen)Belgisch (met Sun dode toetsen)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbers (Algerije, Latijns)Berbers (Algerije, Tifinagh)Berbers (Marokko, Tifinagh alternatief fonetisch)Berbers (Marokko, Tifinagh alternatief)Berbers (Marokko, Tifinagh fonetisch uitgebreid)Berbers (Marokko, Tifinagh uitgebreid)Berbers (Marokko, Tifinagh fonetisch)Berbers (Marokko, Tifinagh)BosnischBosnisch (VS, met Bosnische digrafen)Bosnisch (VS, met Bosnische lettertekens)Bosnisch (met Bosnische digrafen)Bosnisch (met Franse aanhalingstekens)Beide Alt-toetsen samenBeide Ctrl-toetsen samenBeide Shift-toetsen samenBeide Shift-toetsen samen zetten CapsLock aanBeide Shift-toetsen samen zetten CapsLock aan; één Shift-toets zet het uitBeide Shift-toetsen samen zetten ShiftLock aanBrailleBraille (linkshandig, omgekeerde duim)Braille (linkshandig)Braille (rechtshandig, omgekeerde duim)Braille (rechtshandig)Brother InternetBulgaarsBulgaars (nieuw fonetisch)Bulgaars (traditioneel fonetisch)BirmaansBirmaans (Zawgyi)Kameroens meertalig (AZERTY)Kameroens meertalig (Dvorak)Kameroens meertalig (QWERTY)Canadees meertaligCanadees meertalig (eerste deel)Canadees meertalig (tweede deel)CapsLockCapsLock (ingedrukt gehouden); Alt+CapsLock geeft de oorspronkelijke CapsLock-actieCapsLock werkt als Shift met vergrendeling; Shift heft CapsLock tijdelijk opCapsLock werkt als Shift met vergrendeling; Shift heft CapsLock niet opCapsLock is Ctrl-toets, Ctrl is Hyper-toetsCapsLock is Ctrl-toetsGedrag van CapsLock-toetsCapsLock is ook een Ctrl-toetsCapsLock is uitgeschakeldCapsLock naar eerste indeling; Shift+CapsLock naar laatste indelingCapsLock schakelt Shift-vergrendeling aan/uit (beïnvloedt alle toetsen)CapsLock beïnvloedt alleen alfabetische tekensCapsLock gebruikt interne conversie naar hoofdletters; Shift heft CapsLock tijdelijk opCapsLock gebruikt interne conversie naar hoofdletters; Shift heft CapsLock niet opCapsLock; vergrendelt eenmalig samen met andere derdeniveaukiezerCatalaans (Spanje, met middenpunts L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alternatief)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineesChromebookKerkslavischTsjoevasjischTsjoevasjisch (Latijns)Classmate PCCloGaelachCœur d'Alène SalishCompaq Armada-laptopCompaq Easy AccessCompaq Internet (13 toetsen)Compaq Internet (18 toetsen)Compaq Internet (7 toetsen)Compaq Presario-laptopCompaq iPaqCreative Desktop Wireless 7000Krim-Tataars (Dobruja Q)Krim-Tataars (Turks Alt-Q)Krim-Tataars (Turks F)Krim-Tataars (Turks Q)KroatischKroatisch (VS, met Kroatische digrafen)Kroatisch (VS, met Kroatische lettertekens)Kroatisch (met Kroatische digrafen)Kroatisch (met Franse aanhalingstekens)Ctrl zit op de Alt-toetsen; Alt zit op de Windows-toetsenCtrl zit op de Windows-toetsen én op de gewone Ctrl-toetsenPositie van Ctrl-toetsCtrl + Alt + BackspaceCtrl + ShiftTsjechischTsjechisch (QWERTY)Tsjechisch (QWERTY, Macintosh)Tsjechisch (QWERTY, brede backslash-toets)Tsjechisch (Sun type 6/7)Tsjechisch (UCW, alleen lettertekens met accenten)Tsjechisch (VS, Dvorak, UCW-ondersteuning)Tsjechisch (voor coderen)Tsjechisch (voor programmeren)Tsjechisch (voor programmeren, typografisch)Tsjechisch (typografisch)Tsjechisch (met &lt;\|&gt;-toets)Tsjechisch, Slowaaks en Duits (VS)DTK2000DeensDeens (Dvorak)Deens (Macintosh)Deens (Macintosh, zonder dode toetsen)Deens (Sun type 6/7)Deens (Windows-toetsen)Spaans (zonder dode toetsen)Standaard cijferblok-toetsenDellDell 101-toetsen PCDell Inspiron 6000/8000-laptopDell Latitude-laptopDell Precision M-laptopDell Precision M65-laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802NederlandsNederlands (Macintosh)Nederlands (Sun type 6/7)Nederlands (standaard)Nederlands (met Sun dode toetsen)Dyalog APL compleetDzongkhaElfdaals (Zweeds, met combinerende ogonek)Extra typografische tekens aanzettenEngels (3n)Engels (3n, Chromebook)Engels (Australisch)Engels (Kameroen)Engels (Canada)Engels (Carpalx)Engels (Carpalx, volledige optimalisatie)Engels (Carpalx, volledige optimalisatie, internationaal, dode toetsen via AltGr)Engels (Carpalx, volledige optimalisatie, internationaal, met dode toetsen)Engels (Carpalx, internationaal, dode toetsen via AltGr)Engels (Carpalx, internationaal, met dode toetsen)Engels (Colemak)Engels (Dvorak)Engels (Dvorak, alternatief internationaal)Engels (Dvorak, internationaal, met dode toetsen)Engels (Dvorak, linkshandig)Engels (Dvorak, rechtshandig)Engels (Ghana)Engels (Ghana, GILLBT)Engels (Ghana, meertalig)Engels (India, met roepieteken)Engels (Macintosh)Engels (Mali, VS, Macintosh)Engels (Mali, VS, internationaal)Engels (Nigeria)Engels (Norman)Engels (Zuid-Afrika)Engels (GB)Engels (GB, Colemak)Engels (GB, Dvorak)Engels (GB, Dvorak, met Britse leestekens)Engels (GB, Macintosh)Engels (GB, Sun type 6/7)Engels (GB, uitgebreid, Windows-toetsen)Engels (GB, internationaal, Macintosh)Engels (GB, internationaal, met dode toetsen)Engels (VS)Engels (VS, IBM Arabisch 238_L)Engels (VS, Sun type 6/7)Engels (VS, alternatief internationaal)Engels (VS, euroteken op 5)Engels (VS, internationaal, Unicode-combinerend via AltGr)Engels (VS, internationaal, Unicode-combinerend via AltGr, alternatief)Engels (VS, internationaal, met dode toetsen)Engels (Workman)Engels (Workman, internationaal, met dode toetsen)Engels (Dvorak, klassiek)Engels (internationaal, dode toetsen via AltGr)Engels (programmeer-Dvorak)Engels (de delen-/vermenigvuldigen-toetsen schakelen de indeling)Ennyah DKB-1008Enter op cijferblokEsperantoEsperanto (Brazilië, Nativo)Esperanto (Portugal, Nativo)Esperanto (puntkomma en aanhalingsteken op afwijkende plek, historisch)EstischEstisch (Dvorak)Estisch (Sun type 6/7)Estisch (VS, met Estische lettertekens)Estisch (zonder dode toetsen)EurKEY (VS-toetsenbord met Europese lettertekens)Euroteken op 2Euroteken op 4Euroteken op 5Euroteken op EEverex STEPnoteEweFL90FaeröersFaeröers (zonder dode toetsen)FilipijnsFilipijns (Capewell-Dvorak, Baybayin)Filipijns (Capewell-Dvorak, Latijns)Filipijns (Capewell-QWERF 2006, Baybayin)Filipijns (Capewell-QWERF 2006, Latijns)Filipijns (Colemak, Baybayin)Filipijns (Colemak, Latijns)Filipijns (Dvorak, Baybayin)Filipijns (Dvorak, Latijns)Filipijns (QWERTY, Baybayin)FinsFins (DAS)Fins (Macintosh)Fins (Sun type 6/7)Fins (Windows-toetsen)Fins (klassiek)Fins (klassiek, zonder dode toetsen)Fins (Dvorak)Vierniveaus-toets met abstracte scheidingstekensVierniveaus-toets met kommaVierniveaus-toets met puntVierniveaus-toets met punt, beperkt tot Latin-9Vierniveaus-toets met momayyezFransFrans (AFNOR-gestandardiseerde AZERTY)Frans (AZERTY)Frans (Bepo, ergonomisch, Dvorak-manier)Frans (Bepo, ergonomisch, Dvorak-manier, AFNOR)Frans (Bepo, ergonomisch, Dvorak-manier, enkel Latin-9)Frans (Bretons)Frans (Kameroen)Frans (Canada)Frans (Canada, Dvorak)Frans (Canada, historisch)Frans (Democratische Republiek Congo)Frans (Dvorak)Frans (Guinee)Frans (Macintosh)Frans (Mali, alternatief)Frans (Marokko)Frans (Sun type 6/7)Frans (Zwitserland)Frans (Zwitserland, Macintosh)Frans (Zwitserland, Sun type 6/7)Frans (Zwitserland, zonder dode toetsen)Frans (Zwitserland, met Sun dode toetsen)Frans (Togo)Frans (VS-toetsenbord, AZERTY)Frans (VS-toetsenbord met Franse lettertekens)Frans (VS-toetsenbord met Franse lettertekens en dode toetsen, alternatief)Frans (alternatief)Frans (alternatief, enkel Latin-9)Frans (alternatief, zonder dode toetsen)Frans (alternatief, met Sun dode toetsen)Frans (historisch, alternatief)Frans (historisch, alternatief, zonder dode toetsen)Frans (historisch, alternatief, met Sun dode toetsen)Frans (zonder dode toetsen)Frans (met Sun dode toetsen)Friulisch (Italië)Fujitsu-Siemens Amilo-laptopFulaGaAlgemene 101-toetsen PCAlgemene 102-toetsen PC (internationaal)Algemene 104-toetsen PCAlgemene 105-toetsen PC (internationaal)Genius Comfy KB-12eGenius Comfy KB-16M / Genius Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgischGeorgisch (Frankrijk, AZERTY Tskapo)Georgisch (Italië)Georgisch (MESS)Georgisch (ergonomisch)DuitsDuits (uit de Neo-wereld)Duits (Oostenrijk)Duits (Oostenrijk, Macintosh)Duits (Oostenrijk, zonder dode toetsen)Duits (Oostenrijk, met Sun dode toetsen)Duits (Bone)Duits (Bone, eszett op thuisrij)Duits (Dvorak)Duits (KOY)Duits (Macintosh)Duits (Macintosh, zonder dode toetsen)Duits (Neo 2)Duits (Neo qwerty)Duits (Neo qwertz)Duits (QWERTY)Duits (Sun type 6/7)Duits (Zwitserland)Duits (Zwitserland, Macintosh)Duits (Zwitserland, Sun type 6/7)Duits (Zwitserland, historisch)Duits (Zwitserland, zonder dode toetsen)Duits (Zwitserland, met Sun dode toetsen)Duits (T3)Duits (VS, met Duitse lettertekens)Duits (dode aigu)Duits (dode grave en aigu)Duits (dode tilde)Duits (zonder dode toetsen)Duits (met Hongaarse lettertekens en zonder dode toetsen)Duits (met Sun dode toetsen)Duits LadinischGrieksGrieks (Colemak)Grieks (Sun type 6/7)Grieks (uitgebreid)Grieks (zonder dode toetsen)Grieks (meertonig)Grieks (eenvoudig)GujaratiGyrationHTC DreamHanyu pinyin (AltGr)Happy HackingHappy Hacking voor MacHausa (Ghana)Hausa (Nigeria)HebreeuwsHebreeuws (Bijbels, SIL-fonetisch)Hebreeuws (Bijbels, Tiro)Hebreeuws (lyx)Hebreeuws (fonetisch)Hewlett-Packard InternetHewlett-Packard Mini 110-laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimaalHindi (Bolnagri)Hindi (KaGaPa-fonetisch)Hindi (Wx)Honeywell EuroboardHTC Dream-telefoonHongaarsHongaars (101, QWERTY, komma, dode toetsen)Hongaars (101, QWERTY, komma, zonder dode toetsen)Hongaars (101, QWERTY, punt, dode toetsen)Hongaars (101, QWERTY, punt, zonder dode toetsen)Hongaars (101, QWERTZ, komma, dode toetsen)Hongaars (101, QWERTZ, komma, zonder dode toetsen)Hongaars (101, QWERTZ, punt, dode toetsen)Hongaars (101, QWERTZ, punt, zonder dode toetsen)Hongaars (102, QWERTY, komma, dode toetsen)Hongaars (102, QWERTY, komma, zonder dode toetsen)Hongaars (102, QWERTY, punt, dode toetsen)Hongaars (102, QWERTY, punt, zonder dode toetsen)Hongaars (102, QWERTZ, komma, dode toetsen)Hongaars (102, QWERTZ, komma, zonder dode toetsen)Hongaars (102, QWERTZ, punt, dode toetsen)Hongaars (102, QWERTZ, punt, zonder dode toetsen)Hongaars (QWERTY)Hongaars (zonder dode toetsen)Hongaars (standaard)Hyper zit op de Windows-toetsenIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIJslandsIJslands (Dvorak)IJslands (Macintosh)IJslands (Macintosh, historisch)IJslands (zonder dode toetsen)IJslands (met Sun dode toetsen)IgboIndischIndonesisch (Arabisch Melayu, uitgebreid fonetisch)Indonesisch (Arabisch Melayu, fonetisch)Internationaal fonetisch alfabetInuktitutIrakeesIersIers (UnicodeExpert)ItaliaansItaliaans (IBM 142)Italiaans (Macintosh)Italiaans (Sun type 6/7)Italiaans (VS, met Italiaanse lettertekens)Italiaans (Windows-toetsen)Italiaans (internationaal, met dode toetsen)Italiaans (zonder dode toetsen)Italiaans LadinischJapansJapans (Dvorak)Japans (Kana 86)Japans (Kana)Japans (Macintosh)Japans (OADG 109A)Japans (PC-98)Japans (Sun type 6)Japans (Sun type 7 - PC-compatibel)Japans (Sun type 7 - Sun-compatibel)Japanse toetsenbordoptiesKalmykKana Lock-toets is vergrendelendKannadaKannada (KaGaPa-fonetisch)KasjoebischKazachsKazachs (Latijns)Kazachs (uitgebreid)Kazachs (met Russisch)Toetscombinatie om de X-server af te brekenToegang tot het vijfde niveauToegang tot het derde niveauKeytronic FlexProKhmer (Cambodja)KikuyuKinesisKomiKoreaansKoreaans (101/104-toetsen compatibel)Koreaans (Sun type 6/7)Koreaanse Hangul-/Hanja-toetsenKoerdisch (Iran, Arabisch-Latijns)Koerdisch (Iran, F)Koerdisch (Iran, Latijns Alt-Q)Koerdisch (Iran, Latijns Q)Koerdisch (Irak, Arabisch-Latijns)Koerdisch (Irak, F)Koerdisch (Irak, Latijns Alt-Q)Koerdisch (Irak, Latijns Q)Koerdisch (Syrië, F)Koerdisch (Syrië, Latijns Alt-Q)Koerdisch (Syrië, Latijns Q)Koerdisch (Turkije, F)Koerdisch (Turkije, Latijns Alt-Q)Koerdisch (Turkije, Latijns Q)KutenaiKirgizischKirgizisch (fonetisch)LaoLao (STEA voorgestelde standaard indeling)LetsLets (F)Lets (Sun type 6/7)Lets (VS, Colemak)Lets (VS, Colemak, apostrof-variant)Lets (VS, Dvorak)Lets (VS, Dvorak, Y-variant)Lets (VS, Dvorak, min-variant)Lets (aangepast)Lets (apostrof)Lets (ergonomisch, ŪGJRMV)Lets (modern)Lets (VS, programmeer-Dvorak)Lets (VS, programmeer-Dvorak, Y-variant)Lets (VS, programmeer-Dvorak, min-variant)Lets (tilde)Indeling van het cijferblokLinker Alt-toetsLinker Alt-toets (ingedrukt gehouden)Linker Alt is Ctrl, linker Ctrl is Windows-toets, linker Windows-toets is AltLinker Alt- en linker Windows-toets omwisselenLinker Alt + linker ShiftLinker Ctrl-toetsLinker Ctrl is Meta-toetsLinker Ctrl naar eerste indeling; rechter Ctrl naar laatste indelingLinker Ctrl + linker ShiftLinker Ctrl + linker Windows-toetsLinker Ctrl + Windows-toets naar eerste indeling, rechter Ctrl + Menu-toets naar tweede indelingLinker Shift-toetsLinker Windows-toetsLinker Windows-toets (ingedrukt gehouden)Linker Windows-toets;vergrendelt eenmalig samen met andere vijfdeniveaukiezerLinker Windows-toets naar eerste indeling; rechter Windows/Menu-toets naar laatste indelingHistorischHistorisch Wang 724Historisch met kommaHistorisch met puntLitouwsLitouws (IBM LST 1205-92)Litouws (LEKP)Litouws (LEKPa)Litouws (Sun type 6/7)Litouws (VS, Dvorak met Litouwse lettertekens)Litouws (VS, met Litouwse lettertekens)Litouws (standaard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alternatief)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop optischLogitech Cordless Desktop Pro (tweede alternatief)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 (extra toetsen via G15daemon)Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBNedersorbischNedersorbisch (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (internationaal)MacedonischMacedonisch (zonder dode toetsen)MacintoshMacintosh oudToetscompatibiliteit behouden met oude Solaris-toetscodesVan CapsLock een extra Backspace makenVan CapsLock een extra Esc makenVan CapsLock een extra Hyper makenVan CapsLock een extra Menu-toets makenVan CapsLock een extra NumLock makenVan CapsLock een extra Super makenVan de Zenkaku Hankaku-toets een extra Esc-toets makenRechter Alt is een Hangul-toetsRechter Alt is een Hanja-toetsRechter Ctrl is een Hangul-toetsRechter Ctrl is een Hanja-toetsEnkele CapsLock is een extra Esc, maar Shift+CapsLock is gewone CapsLockMaleis (Jawi, arabisch toetsenbord)Maleis (Jawi, fonetisch)MalayalamMalayalam (Lalitha)Malayalam (verbeterd Inscript, met roepieteken)MalteesMaltees (Engelse indeling met AltGr-extras)Maltees (Amerikaanse indeling met AltGr-extras)Maltees (met Amerikaanse indeling)Meitei (Eeyek)MaoriMarathi (KaGaPa-fonetisch)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu-toets (ingedrukt gehouden), Shift+Menu voor MenuMenu is rechter Ctrl-toetsMenu zit op de Windows-toetsenMeta zit op de linker Windows-toetsMeta zit op de Windows-toetsenMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Zweeds)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB / Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office-toetsenbordMicrosoft Wireless Multimedia 1.0AOverige compatibiliteitsoptiesMmuockMoldavischMoldavisch (Gagauz)MongoolsMongools (Bichig)Mongools GalikMongools ManchuMongools Manchu GalikMongools TodoMongools Todo GalikMongools XibeMontenegrijnsMontenegrijns (Cyrillisch, met Franse aanhalingstekens)Montenegrijns (Cyrillisch)Montenegrijns (Cyrillisch, ZE en ZHE omgewisseld)Montenegrijns (Latijns, met Franse aanhalingstekens)Montenegrijns (Latijns, QWERTY)Montenegrijns (Latijns, Unicode)Montenegrijns (Latijns, Unicode, QWERTY)Meertalig (Canada, Sun type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F-stijl backspaceNepaleesHarde spatie op het tweede niveauHarde spatie op het derde niveauHarde spatie op het derde niveau, niets op het vierde niveauHarde spatie op het derde niveau, smalle harde spatie op het vierde niveauHarde spatie op het vierde niveauHarde spatie op het vierde niveau, smalle harde spatie op het zesde niveauHarde spatie op het vierde niveau, smalle harde spatie op het zesde niveau (via Ctrl+Shift)Noord-Samisch (Finland)Noord-Samisch (Noorwegen)Noord-Samisch (Noorwegen, zonder dode toetsen)Noord-Samisch (Zweden)Northgate OmniKey 101NoorsNoors (Colemak)Noors (Dvorak)Noors (Macintosh)Noors (Macintosh, zonder dode toetsen)Noors (Sun type 6/7)Noors (Windows-toetsen)Noors (zonder dode toetsen)NumLockNumLock aan: cijfers; Shift voor cursortoetsen. Numlock uit: cursortoetsen (zoals in Windows)Cijfertoets 4 wanneer alléén ingedruktCijfertoets 9 wanneer alléén ingedruktGedrag van Delete-toets op cijferblokCijferblok-toetsen geven altijd cijfers (net als bij Mac OS)OLPCOccitaansOghamOgham (IS434)Ol ChikiOud-HongaarsOriyaOrtek Multimedia/Internet MCK-800Ossetisch (Georgië)Ossetisch (Windows-toetsen)Ossetisch (historisch)PC-98Pannonisch RusynPositie van ronde haakjesPashtoPashto (Afghanistan, OLPC)PausePerzischPerzisch (Afghanistan, Dari OLPC)Perzisch (met Perzisch cijferblok)PoolsPools (Brits toetsenbord)Pools (Colemak)Pools (Dvorak)Pools (Dvorak, met Poolse aanhalingstekens op toets 1)Pools (Dvorak, met Poolse aanhalingstekens op aanhalingstekentoets)Pools (Duitsland, zonder dode toetsen)Pools (glagolitisch)Pools (QWERTZ)Pools (Sun type 6/7)Pools (internationaal, met dode toetsen)Pools (historisch)Pools (programmeer-Dvorak)PortugeesPortugees (Brazilië)Portugees (Brazilië, Dvorak)Portugees (Brazilië, IBM/Lenovo ThinkPad)Portugees (Brazilië, Nativo voor VS-toetsenborden)Portugees (Brazilië, Nativo)Portugees (Brazilië, Sun type 6/7)Portugees (Brazilië, zonder dode toetsen)Portugees (Colemak)Portugees (Macintosh)Portugees (Macintosh, zonder dode toetsen)Portugees (Macintosh, met Sun dode toetsen)Portugees (Nativo voor VS-toetsenborden)Portugees (Nativo)Portugees (Sun type 6/7)Portugees (zonder dode toetsen)Portugees (met Sun dode toetsen)Positie van samensteltoetsPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Rechter Alt-toetsRechter Alt-toets (ingedrukt gehouden)Rechter Alt-toets kiest het vijfde niveauRechter Alt-toets; vergrendelt eenmalig samen met andere vijfdeniveaukiezerRechter Alt-toets geeft nooit het derde niveauRechter Alt-toets; Shift + rechter Alt-toets is samensteltoetsRechter Ctrl-toetsRechter Ctrl-toets (ingedrukt gehouden)Rechter Ctrl is rechter Alt-toetsRechter Ctrl + rechter ShiftRechter Shift-toetsRechter Windows-toetsRechter Windows-toets (ingedrukt gehouden)Rechter Windows-toets; vergrendelt eenmalig samen met andere vijfdeniveaukiezerRoemeensRoemeens (Duitsland)Roemeens (Duitsland, zonder dode toetsen)Roemeens (Sun type 6/7)Roemeens (Windows-toetsen)Roemeens (cedilla)Roemeens (ergonomisch Touchtype)Roemeens (standaard cedilla)Roemeens (standaard)Roepieteken op 4RussischRussisch (Tsjechisch, fonetisch)Russisch (DOS)Russisch (Georgisch)Russisch (Duitsland, fonetisch)Russisch (Duitsland, aangeraden)Russisch (Duitsland, transliteratie)Russisch (Kazachstan, met Kazachs)Russisch (Macintosh)Russisch (Polen, fonetisch Dvorak)Russisch (Polyglot en Reactionary)Russisch (Rulemak, fonetisch Colemak)Russisch (Sun type 6/7)Russisch (Zweden, fonetisch)Russisch (Zweden, fonetisch, zonder dode toetsen)Russisch (VS, fonetisch)Russisch (Oekraïne, standaard RSTU)Russisch (historisch)Russisch (fonetisch, YAZHERTY)Russisch (fonetisch)Russisch (fonetisch, AZERTY)Russisch (fonetisch, Dvorak)Russisch (fonetisch, Frans)Russisch (fonetisch, Windows-toetsen)Russisch (typemachine)Russisch (typemachine, historisch)Russisch (met Amerikaanse leestekens)Russisch (met Oekraïens-Wit-Russische indeling)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskriet (KaGaPa-fonetisch)Sanwa Supply SKB-KG3Scroll-LockSecwepemctsinPuntkomma op derde niveauServischServisch (Cyrillisch, met Franse aanhalingstekens)Servisch (Cyrillisch, ZE en ZHE omgewisseld)Servisch (Latijns met Franse aanhalingstekens)Servisch (Latijns)Servisch (Latijns, QWERTY)Servisch (Latijns, Unicode)Servisch (Latijns, Unicode, QWERTY)Servisch (Rusland)Servisch (combinerende accenten in plaats van dode toetsen)Servo-Kroatisch (VS)Shift + NumLock zetten 'muistoetsen' aanShift schakelt CapsLock uitShift heft NumLock niet op, maar kiest het derde niveauShift + CapsLockSiciliaansSiciliaans (VS-toetsenbord)SilezischSilvercrest Multimedia WirelessSindhiSingalees (VS, met Singalese lettertekens)Singalees (fonetisch)SlowaaksSlowaaks (QWERTY)Slowaaks (QWERTY, brede backslash-toets)Slowaaks (Sun type 6/7)Slowaaks (brede backslash-toets)SloveensSloveens (VS, met Sloveense lettertekens)Sloveens (met Franse aanhalingstekens)SpaansSpaans (Dvorak)Spaans (Latijns-Amerika)Spaans (Latijns-Amerika, Colemak voor gaming)Spaans (Latijns-Amerika, Colemak)Spaans (Latijns-Amerika, Dvorak)Spaans (Latijns-Amerika, dode tilde)Spaans (Latijns-Amerika, zonder dode toetsen)Spaans (Latijns-Amerika, met Sun dode toetsen)Spaans (Macintosh)Spaans (Sun type 6/7)Spaans (Windows-toetsen)Spaans (dode tilde)Spaans (zonder dode toetsen)Spaans (met Sun dode toetsen)Speciale toetsen (Ctrl+Alt+&lt;toets&gt;) afgehandeld in een serverSteelSeries Apex 300 (Apex RAW)Sun-toetsen-compatibiliteitSun type 6 (Japans)Sun type 6 USB (Japans)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europees)Sun type 7 USBSun type 7 USB (Europees)Sun type 7 USB (Japans) / Japanse 106-toetsenSun type 7 USB (Unix)Super Power MultimediaSwahili (Kenia)Swahili (Tanzania)Ctrl en CapsLock omwisselenEsc en CapsLock omwisselenLinker Alt en linker Ctrl omwisselenLinker Windows-toets en linker Ctrl omwisselenRechter Windows-toets en rechter Ctrl omwisselenVerwisselen met vierkante haakjesZweedsZweeds (Dvorak A5)Zweeds (Dvorak)Zweeds (Macintosh)Zweeds (Sun type 6/7)Zweeds (Svdvorak)Zweeds (VS, met Zweedse lettertekens)Zweeds (gebaseerd op VS internationale Dvorak)Zweeds (zonder dode toetsen)Zweedse gebarentaalOverschakelen naar een andere indelingSymplon PaceBook-tabletSyrischSyrisch (fonetisch)TaiwaneesTaiwanees (oorspronkelijk)TadzjieksTadzjieks (historisch)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB-codering)Tamil (TamilNet '99 met Tamil-cijfertekens)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB-codering)Tamil (TamilNet '99, TSCII-codering)Targa Visionary 811TatarTeluguTelugu (KaGaPa-fonetisch)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetaansTibetaans (met ASCII-cijfers)Aan de gerelateerde toets in een Colemak-indelingAan de gerelateerde toets in een Dvorak-indelingAan de gerelateerde toets in een QWERTY-indelingToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard, model 227 (brede Alt-toetsen)Truly Ergonomic Computer Keyboard, model 229 (gewone Alt-toetsen, extra Super- en Menu-toetsen)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurksTurks (Alt-Q)Turks (F)Turks (Duitsland)Turks (Sun type 6/7)Turks (internationaal, met dode toetsen)Turks (met Sun dode toetsen)TurkmeensTurkmeens (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU-modus)TypeMatrix EZ-Reach 2030 USB (106:JP-modus)UdmurtsUgaritisch in plaats van ArabischOekraïensOekraïens (Sun type 6/7)Oekraïens (Windows-toetsen)Oekraïens (homofonisch)Oekraïens (historisch)Oekraïens (fonetisch)Oekraïens (standaard RSTU)Oekraïens (typemachine)Unicode-aanvullingen (pijlen en wiskundige operatoren)Unicode-aanvullingen (pijlen en wiskundige operatoren; de laatste op standaardniveau)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows-toetsen)Urdu (alternatief fonetisch)Urdu (fonetisch)Toetsenbord-LED gebruiken om alternatieve indeling te tonenGebruik van spatiebalk voor het invoeren van harde (niet-afbrekende) spatiesGewone spatie op elk niveauOeigoersOezbeeksOezbeeks (Afghanistan)Oezbeeks (Afghanistan, OLPC)Oezbeeks (Latijns)ViëtnameesViëtnamees (AÐERTY)Viëtnamees (Frans toetsenbord met Viëtnamese lettertekens)Viëtnamees (QĐERTY)Viëtnamees (VS-toetsenbord met Viëtnamese lettertekens)ViewSonic KU-306 InternetWang 724 cijferblok met Unicode-aanvullingen (pijlen en wiskundige operatoren)Wang 724 cijferblok met Unicode aanvullingen (pijlen en wiskundige operatoren; de laatste op standaardniveau)Van de PrtSc-toets een extra Windows-toets makenWindows-toets + SpatieWinbook, model XP5WolofYahoo! InternetJakoetsYorubaNulbreedte-losmaker op het tweede niveauNulbreedte-losmaker op het tweede niveau, harde spatie op het derde niveauNulbreedte-losmaker op het tweede niveau, harde spatie op het derde niveau, niets op het vierde niveauNulbreedte-losmaker op het tweede niveau, harde spatie op het derde niveau, smalle harde spatie op het vierde niveauNulbreedte-losmaker op het tweede niveau, harde spatie op het derde niveau, nulbreedte-verbinder op het vierde niveauNulbreedte-losmaker op het tweede niveau, nulbreedte-verbinder op het derde niveauNulbreedte-losmaker op het tweede niveau, nulbreedte-verbinder op het derde niveau, harde spatie op het vierde niveauNulbreedte-losmaker op het derde niveau, nulbreedte-verbinder op het vierde niveauakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800-laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh

?>